SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X8JWH7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X8JWH7
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.41e-78
Family Capz alpha-1 subunit 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X8JWH7
Sequence length 282
Comment (tr|X8JWH7|X8JWH7_9HOMO) F-actin capping protein, alpha subunit {ECO:0000313|EMBL:EUC67368.1} KW=Complete proteome OX=1086054 OS=Rhizoctonia solani AG-3 Rhs1AP. GN=RSOL_501910 OC=Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
Sequence
MDSAQRLSAAASFILQSPPGEINDVISDLRNIVNDDDALQEGIQPSLEKYNQEQFVCVTV
PGHEHQVIVSSAGLIPESGRFLDPRTKTSFVFDHLTLTASEPEPVEVDAESEPFRSALEE
STLKYLAEYFQDGVGSVFALSPTNLVVQIVANKYNPQNFWSGRWRSEYSIDLEKGEISGK
VFVNVHYYEQGNVQLQTVYTPAFSLPTGLTPSSAPKILAIIGEKEGEHERALSDAYADLG
EKSYKSLRRALPLTRQKLDWDKVLGYKLGAELAASRGAFGTT
Download sequence
Identical sequences A0A074S9C5 X8JWH7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]