SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for X8K7P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X8K7P3
Domain Number - Region: 63-170
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz alpha-1 subunit 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X8K7P3
Sequence length 435
Comment (tr|X8K7P3|X8K7P3_9STRE) McrBC 5-methylcytosine restriction system component {ECO:0000313|EMBL:EUC79482.1} KW=Complete proteome OX=1161416 OS=Streptococcus sp. SR1. GN=HMPREF1518_1047 OC=Streptococcus.
Sequence
MMRITDNQHRIAKEDFVAEYPKLSQALLDRTLDNLSKENSIFIFPNDLKHSPDLDKDQKI
FETVNQEIKTGNVIGFLGYGQERLTIASRFSDESNDHFLHYLLQKVLNINLTSLDVGLSP
EDKLYQLLIYLFPKYLQAALRKGLYKEYQRFFYNDSHVKGVLDVGNHLKKNLPFTGNIAY
ITREFTYDNPLMQLIRHTIEYIKNQKSFGVLLDSNRENMTEITRVTSSYKLADRAKIIRM
NKIKPIRHAYFREYRKLQELCLMILSREKHGLGPQAQKVHGILFDVAWLWEEYVYSLLPK
GFIHPRNKDKTDGISVFSVGKRKVYPDFYDRERKIVLDAKYKKLEFTEKGINREDLFQLI
SYSYILKSEKAGLIFPSMEQSVNSEIGKLAGYGAQLKKWSIQIPQNASSYSAFCKMMENS
EENFKAIIDEEVGRK
Download sequence
Identical sequences X8K7P3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]