SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A009FPX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A009FPX6
Domain Number 1 Region: 435-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000177
Family Anti-sigma factor antagonist SpoIIaa 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A009FPX6
Sequence length 559
Comment (tr|A0A009FPX6|A0A009FPX6_ACIBA) Sulfate permease family protein {ECO:0000313|EMBL:EXA65257.1} KW=Complete proteome OX=1310605 OS=Acinetobacter baumannii 348935. GN=J504_2130 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MTLKSDVLAALIVVAMLVPQGMAYAMLAGLPPIMGLYASILPMIIYALLGGSTTLSIGPV
AIISMMTFTTLNPLFEVGSPVYIEAATLLALMVGIISLLLGVFRFGFLIQLISHPVIQSF
IIASALLIAFGQFKFLVDLPLKANNIPELVKSLVEYLPLLHLPSLIFGLLSIGLLVYLPK
LLKSQAIQSRIGSTDFLVRAVPLILVFLGIAAVLFFDLKVQGIKTVGEIPLGFPPLSFPH
WNWELVMTLLPGASMIAMISFVESLSIAQATALQQRSNLNSNQELIALGVANISAGISSA
FPVTGSLSRTVVNADAGAKTPLAGVLSSLLIVVVSLFFTSFFEDLPLTILAATIIVSIWK
LVNFQPFVDAWRYSKADGIAMWITFFGVVLLDITTGLIVGIISTFILMLWRISRPHIAVV
GLVEGTQHFRNIQRHQVMTSDRVLSLRIDENLSFLNAHTLKGYLINQLSLNDKLEHVILN
CSSISAIDLSALETLEELNAELSKLDIRLHFAEVKGPVFDRLQASKLMTHLSGRIYLTHF
QAIQDLAPEIFEKPQHYMI
Download sequence
Identical sequences A0A009FPX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]