SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A011AAH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A011AAH2
Domain Number 1 Region: 5-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-76
Family Protein kinases, catalytic subunit 0.0000000142
Further Details:      
 
Domain Number 2 Region: 497-557
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000262
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 431-491
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000523
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 
Weak hits

Sequence:  A0A011AAH2
Domain Number - Region: 363-425
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000124
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A011AAH2
Sequence length 607
Comment (tr|A0A011AAH2|A0A011AAH2_9ACTN) Protein kinase family protein with PASTA protein {ECO:0000313|EMBL:EXG79016.1} KW=Complete proteome; Reference proteome OX=927661 OS=Cryptosporangium arvum DSM 44712. GN=CryarDRAFT_0030 OC=Cryptosporangium.
Sequence
MTEARLFGGRYEIGHVLGYGGMAEVHMGRDHRLGRDVAIKVLRSDLARDPGFQARFRREA
QNAAALNHPAIVSVYDTGEDHSSRDGVAVPYIVMEYVEGLTLKEVLTAEGRLVPQRALEI
VADVCAALDFSHRHGIIHRDIKPGNVMLTPQGAVKVMDFGIARAITSASSQMTATSAVIG
TAQYLSPEQARGETVDARSDVYSTGCLLYELMVGEPPFTGDNPVSVAYQHVREDPIPPSQ
RNPEISATIDSIVLKSMAKNPAQRYQSAGEMRADLLRAAAGRPVAAGPVPTGGERTAVLG
GGAATRVVPTPGGGYSTSVGTAVGNGAEKRRGATIAVGILAVVALVAVVAFAASKLGGGG
GKEVTVADVVGANQVSATRELQAQGLNVTVRTVPSTTEQKGKVTEQNPAAGEKAKEGDKV
EISIGGGPGEVAVPDLKGLDEDGAKQRLEQAKLQFKPEDDEDSDLPEGRVTGQDPAPGQK
LPENGTVTVRISKANRVLVPDVKGLTFDDAKSRLENAGLKARKAEAASDKAAGTVISQTP
DQNTKQNRGTTVTLTVSTGPTASDSPDPDESPSEDPEPSDSAEPTESAGASASAGSTPRV
GPNTLTR
Download sequence
Identical sequences A0A011AAH2
WP_051569518.1.96358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]