SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A014FGE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A014FGE1
Domain Number 1 Region: 38-128
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A014FGE1
Sequence length 131
Comment (tr|A0A014FGE1|A0A014FGE1_9GAMM) STAS domain protein {ECO:0000313|EMBL:EXT61881.1} KW=Complete proteome OX=1310914 OS=Acinetobacter sp. 25977_10. GN=J813_4216 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MIATVVVVVATHNLALGVLTGVLLSALFLANKLENDVHVITSLEGNYRLYDLRGQIFFSS
SDKFMQSFNFKEEVKEVIIDLTHSRIWDITSVAMLDSAVERFQKNGIQVTVRGLNEANSV
MIDKYGTHAKI
Download sequence
Identical sequences A0A014FGE1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]