SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A015J2J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A015J2J9
Domain Number 1 Region: 141-259
Classification Level Classification E-value
Superfamily MIR domain 0.0000000000746
Family MIR domain 0.0024
Further Details:      
 
Weak hits

Sequence:  A0A015J2J9
Domain Number - Region: 65-129
Classification Level Classification E-value
Superfamily Rotavirus nonstructural proteins 0.0994
Family NSP3 C-terminal domain, NS34 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A015J2J9
Sequence length 324
Comment (tr|A0A015J2J9|A0A015J2J9_9GLOM) Uncharacterized protein {ECO:0000313|EMBL:EXX63707.1} KW=Complete proteome; Reference proteome OX=1432141 OS=Rhizophagus irregularis DAOM 197198w. GN=RirG_149780 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MELPKYSGTIHPQEWLKQVLIFCYFKQIKDDKEVLNICKTMINSTIIIPNVNEIKSFEEL
IEALKLHSTFNTFKISCKRKLQMMKFIPEQHDDIATFLANFHSLCNDAEINDHEEIITLL
INSYSNYFFKSEFIKRVEGINSVDEIFKIFSEVVFDELKIIKFGSSIALKHVATGKYLSS
CNVNYKTGSNQRVFAGEKFPDEDALWYATTSHNFQHCTYDDGFDLTHKVTGNKLGINSSY
RSPTTGHFEVNCRNGSSSLNWINTNTTNNNAPYVKAKDVIALKCGISIFRSHDFTFTIGN
KTFQEVVGHNERIGGNDEWQIEIV
Download sequence
Identical sequences A0A015J2J9 A0A2H5SB85

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]