SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022QKB4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QKB4
Domain Number 1 Region: 223-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-17
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 49-185
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000178
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022QKB4
Sequence length 587
Comment (tr|A0A022QKB4|A0A022QKB4_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU28391.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a003409mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MDSRTAFCDSNDVSGGSSSTCCAATATDSSLSPSPVQLPADVAAIKRLSDTLESVFLSPS
DSDFFADARLVAASGKEIPVHRCILSARTPFFKNLFASRERNAKLKLKELMKEYDVGYDA
LVTVLAYLYSGKIRASPKDVCVCVDDECSHLACRPAVAFMVEVLYASFIFQISELVARFQ
NSLMGILDKTTTDDVLMVLSVANMCGTVCGSLLARAIEIVVKSDLDVITLEKSLPQHIIK
QINESRIALGLLSPENSTCPDKHVKRIHRALESDDVELVRMLLKEERTNLDDAYALHYAV
AYCDSKTTAELLDLAIADINQRNPRGYTVLHVAAMRKDPKIIVSLLTKGARPSDLTSDGR
KALQISKRLTRAIDYYGSTEEGKSTPKDRLCIEILEQAERRDPLPGEASMSLALAGDDLR
TKLLYLENRVALAKLLFPMEAKVAMDIAQVDGTSEFHLSGIHKNQAGSQRTEVDLNEAPF
KIKEEHLNRLRALSKTVELGKRFFPRCSAVLNKIMDRDDYPDIAQMGNGSPEECPLKRQR
RMEIEEVLSKAFTEDKEEIDRTINLSTSSSSSSVGIMRPNGMLPFKN
Download sequence
Identical sequences A0A022QKB4
mgv1a003409m|PACid:17674843 XP_012848196.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]