SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023F1M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023F1M8
Domain Number 1 Region: 535-657
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-39
Family Regulator of G-protein signaling, RGS 0.0000801
Further Details:      
 
Domain Number 2 Region: 11-92
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0091
Further Details:      
 
Domain Number 3 Region: 801-885
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.41e-17
Family Ras-binding domain, RBD 0.0058
Further Details:      
 
Domain Number 4 Region: 197-306
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000043
Family Phosphotyrosine-binding domain (PTB) 0.0099
Further Details:      
 
Domain Number 5 Region: 746-813
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000062
Family Ras-binding domain, RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023F1M8
Sequence length 1155
Comment (tr|A0A023F1M8|A0A023F1M8_TRIIF) Putative regulator of g-protein signaling 12 {ECO:0000313|EMBL:JAC14899.1} OX=30076 OS=Triatoma infestans (Assassin bug). GN= OC=Panheteroptera; Cimicomorpha; Reduviidae; Triatominae; Triatoma.
Sequence
MHAVRRRKKRPNYGVRTVEVKRGQNGFGFTISGQHPCILSCIVPGSPAENAGLRAGDYLV
AVEGQSVSKVPHDDVVRLIGCSNGVLKLQIAESYYSDSSDDDVIIASRQKPKYTHKSRLH
GRAAKVVRDLRTGAMFEEDESVVTPPRNSKPDWKEVSPLVRPLLISCLAESGLSTGYSHN
YHPSLNREPDNHEILTAVVGYVGTIEMPTKLPPQSSLQVVRGCIKRLRAEKRSHTPVLMT
VLSRSLRLASGNGATLAVYPKERVTFCARAQDKDDRHFGVVTTGSGHGDPSSSCHVFALD
PKHHTNLTNRARLFNIECQGEHSSGATKDFPLTSEPIVTLIKSLYEGDGGSCAAGTSGAV
SLGVHRAGVANSPQPSHDSTTTTSNSDSGIGFRDDSGNQSDRILMVEPNSRPQLHVHQLD
KVGNLGEKVNFREMNASCRSRSPLSTGSEGPVFLEEMSVSSAATKSPTEDLASPYKLSPK
VFPTVSQSLEDLKNQEELTRPLPGTHWGSLQDLRVLSTDCESPVHTLHEGAEGGVSSWAT
SFEKLLDDSVGLQTFAEFLKKEFSHENIFFWVACENYRRLEDVEERKRKAKEIFECHLDL
GALEPVNVDSYARQITEEQLDSAPPDLFLQAQKQIFNLMKFDSYPRFIKSELYKECVVRV
LAGEEIPVKSTSSQLQLNSSVPHTKLMKSWSDAEERCRKSLLGWAVRRGWAKSRDRTDNY
SDEGGNSVSSSISSLSTWDVALSSGLTRVGLPDGSTAVVPARPGLTVRHLITNLLSKRAI
DMPDFNVRFSYRNKMVCLDDDASSLSGQEVTVERKVVFRLDLPNRKTILVKSRGCNTLSH
VLRPILIKYGYNIDMVTLCLMSENEVVEPSVSVTQVHNQRIQVLTRSTPTNCLSQIAGWR
IDDTSNKAKSLDEITNRVFEELLQGKVESSNPVLSDQGSVRSQDWGSESSSGILDRFLRC
DSAFIDKQRKSKKNQSKSEESERKSTLSKLPPLIAKLKPSSKYESRSESDVLYEGLKRAQ
RSRLEDQRGTEINFELPDFLKDKENTPQGGKKVRKIRVDNEEKNPKVYICENGCNRTDHS
SAGTEERHDSVGEVATVSQKDEPLDQQQSQRTSCQSEPPPLPPKPKNLVPWPDDLRPRAR
TRRAVYLDQPSSSFV
Download sequence
Identical sequences A0A023F1M8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]