SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023FQY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023FQY2
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily Mitochondrial ATP synthase coupling factor 6 5.62e-21
Family Mitochondrial ATP synthase coupling factor 6 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023FQY2
Sequence length 109
Comment (tr|A0A023FQY2|A0A023FQY2_9ACAR) ATP synthase-coupling factor 6, mitochondrial {ECO:0000256|PIRNR:PIRNR002455} OX=34607 OS=Amblyomma cajennense (Cayenne tick). GN= OC=Amblyomma.
Sequence
MALNARVTNLARQCFMQCKRNYGVSAVLMQKSLDPIQQLFVDKIREYSQKSKSKSELFVD
ADASITKEYNDELQKAAVMYGGSKGADMTQFPKFDFQEPTLDPINMEQK
Download sequence
Identical sequences A0A023FQY2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]