SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A023XHV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023XHV4
Domain Number 1 Region: 95-161
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 4.06e-31
Family CO dehydrogenase ISP C-domain like 0.00036
Further Details:      
 
Domain Number 2 Region: 12-99
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 7.34e-28
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A023XHV4
Sequence length 163
Comment (tr|A0A023XHV4|A0A023XHV4_BRAJP) Xanthine dehydrogenase yagT iron-sulfur binding protein subunit {ECO:0000313|EMBL:AHY51898.1} KW=Complete proteome OX=476282 OS=Bradyrhizobium japonicum SEMIA 5079. GN=BJS_06546 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MSDVTHEIPERIPVHIVVNGVGHTLDLMPWTTLLDALRDHLALTGTKKGCDHGQCGACTV
LIDGRRVNSCLTLAVMKDGAEITTIEGLAKDGTLHPVQQAFIDHDAFQCGYCTPGQICSA
AGLLAEGRARDADEIRELMSGNLCRCGAYPNIVSAIQQAMGRP
Download sequence
Identical sequences A0A023XHV4 G7DRS5
WP_014496634.1.18950 WP_014496634.1.35620 WP_014496634.1.6944 WP_014496634.1.77977 WP_014496634.1.97209 gi|384220247|ref|YP_005611413.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]