SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024RD91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024RD91
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 2.33e-32
Family Pleckstrin-homology domain (PH domain) 0.000000221
Further Details:      
 
Domain Number 2 Region: 169-262
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000327
Family SH2 domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024RD91
Sequence length 295
Comment (tr|A0A024RD91|A0A024RD91_HUMAN) BCR downstream signaling 1, isoform CRA_a {ECO:0000313|EMBL:EAX05548.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_40344 OC=Catarrhini; Hominidae; Homo.
Sequence
MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDK
KSIIYVDKLDIVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVT
ELSVPQNVSLLPGQVIKLHEVLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFY
TVSRKEATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIEL
EKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPHIA
Download sequence
Identical sequences A0A024RD91 Q9ULZ2
NP_001304698.1.87134 NP_001304698.1.92137 NP_036240.1.87134 NP_036240.1.92137 9606.ENSP00000265404 gi|6912272|ref|NP_036240.1| ENSP00000265404 ENSP00000379527 hss001002916.2 ENSP00000265404 ENSP00000265404 ENSP00000379527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]