SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059A5R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059A5R6
Domain Number 1 Region: 26-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.59e-23
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 406-485
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000667
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059A5R6
Sequence length 500
Comment (tr|A0A059A5R6|A0A059A5R6_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW49178.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_K02760 OC=Eucalypteae; Eucalyptus.
Sequence
MGCKMEACAECSRNCVILHGKNKNASPNVSSFFKVMIGSQFSELLYIPPKFAPTISGQLN
QNIRLEDSGGRQWEVTLSKVDGSFAFQRGWNAFSRDHGLEVGYFLLFYYLGSHFRVDIYD
RTGCRKVDFPENWTSKKRSRSSRNSSDDPTGEKSSSESASVVSGASAELDQCNRGTNVEE
AVKQMASVCLKSGGKSQPLSKMVFAEELSFMMDRHIENREGEEVRPAFDLFDFEMKNNKT
CAGGNPYTVDGTGPSSVGAVLSQLCQDEAGLADKDPILDSVNNRTCEETDQNIKKLENSG
NLVGLDKQETLMNNCKNEVLPDVKRELMEMDEDNNCEVERPRVIKQEQVEMTPGHWSTKM
ANLEIYGKKPIVKAEYTASDGQLAKGEAINAKASSVHMAANTSYSVKVVTDCHSYLELPA
DLPSSFFKGSSSRDRKVVFLTDPSKRTWPVLYHERLGVRSLTSGWDGFRQANGIQRGDDC
VFQLQILSNSQSLYKVSITR
Download sequence
Identical sequences A0A059A5R6
XP_010037470.1.83385 Eucgr.K02760.1|PACid:23604388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]