SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059ABH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ABH0
Domain Number 1 Region: 731-1356
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 1.01e-182
Family Molybdenum cofactor-binding domain 0.00000000000806
Further Details:      
 
Domain Number 2 Region: 248-452
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.94e-58
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.00000938
Further Details:      
 
Domain Number 3 Region: 591-732
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 3.14e-40
Family CO dehydrogenase molybdoprotein N-domain-like 0.0000566
Further Details:      
 
Domain Number 4 Region: 456-569
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.01e-33
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0000832
Further Details:      
 
Domain Number 5 Region: 115-185
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 9.81e-32
Family CO dehydrogenase ISP C-domain like 0.0000694
Further Details:      
 
Domain Number 6 Region: 22-107
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.18e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059ABH0
Sequence length 1373
Comment (tr|A0A059ABH0|A0A059ABH0_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW51193.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_J00780 OC=Eucalypteae; Eucalyptus.
Sequence
MGSLKSEEELERIDDEAAASKEAILYVNGSRKVLPDGLAHLTLLEYLRGIGLTGTKLGCG
EGGCGACTVMVSHYNESLKKCRHYAVNACLAPLYSVEGMHVITVEGIGNRMHGLHPVQES
LARAHGSQCGFCTPGFIMSMYALLRSSQSPPPEEQIDECLSGNLCRCTGYRPILDAFRVF
AKTENSLYGPQPSSSSVEESNVVCPSTGKPCSCRSGSLVDSEPTRESICCGQKYKAISYD
EVDGSLYAEKELIFPPELLLRKISYLSLSGFNGLKWYRPSRLKQVLELKSRYPDAKLLVG
NTEVGIEMRLKRMHYPVLISTMHVPELNVLDVKDDGVEIGAAVRLSDLLTVFRKVVTERA
YHETSTCKAFIEQLKWFAGTQIKNVASVGGNICTASPISDLNPLWMASRAKFRVIDGKGN
LRIVSAENFFLGYRKVDLASGEILLSVFLPWSRSLEYVKEFKQAHRRDDDIAIVNAGMRV
FLEKKDDNLVVADASIVYGGVAPLSIAARQTKEYLIGRTWNQELLQGALEVLRSDILIKE
NAPGGMVEFRRSLILSFFFKFFLWVSHEMDGMRSIKEEIPLSHISAIKPFERPSVIGCQD
YEIVKRGTAVGSPEVHLSARLQVTGEAEYADDIALPPNGLNAALVLSRKPHARIISVDDS
QAKSSPGFAGIFLAKDVPRKNKIGHVINDEELFASEFVSCVGQVIGVVVADTQENAKLAA
RKVHVEYEELPAIFSIEDAIKAKSFHPNTERFLGKGDVDLCFQSGECYKVIQGEVQVGGQ
EHFYLEPQSTVIWTVDGGNEVHMVSSTQAPQKHQKYVSGVLGLPMSKVVCRIKRLGGGFG
GKETRSAFLAAAASVPSYLLNRPVKITLDRDADMMITGQRHSFLGKYKVGFTKEGKVLAL
DLEIYNNAGNSLDLSLAILEHAMFHSDNVYEIPNIRINGRVCFTNFPSNTAFRGFGGPQG
MLIAENWIQRIAVELKKSPEEIKEMNFQGEGSVLHYGQQLQHCKLGQLWNALKESCNFLN
ARKEADQFNLQNRWKKRGVAMVPTKFGISFTTKLLNQAGALVQVYTDGTVLVTHGGVEMG
QGLHTKVAQVAASSFNIPLTSVFISETSTDKVPNASPTAASASSDMYGAAVLDACEQIKA
RMEPIASRKNFSSFAELASACYVERIDLSAHGFHIVPEIGFDWKTGKGNPFRYHTYGAAY
AELEIDTLTGDFHTRDANVFLDLGYSINPAIDVGQIEGAFVQGLGWVALEELKWGDAAHK
WIPPGCLYTCGPGTYKIPSVNDVPLKFSVSLLKGHPNVKAIHSSKAVGEPPFFLASSVFF
AIKDAIIAARADAGFTDWFPLDNPATPERIRMACLDEFTAPFVGSDFRPKLSV
Download sequence
Identical sequences A0A059ABH0
Eucgr.J00780.1|PACid:23598624 XP_010031803.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]