SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059AKX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059AKX0
Domain Number 1 Region: 15-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-24
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059AKX0
Sequence length 199
Comment (tr|A0A059AKX0|A0A059AKX0_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW54458.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_I00406 OC=Eucalypteae; Eucalyptus.
Sequence
MTNVSYSWKRYEPLESPHFFKIILSDTLQSGKLIIPKRFVAKYGNRLPNQLLLKVAGDGN
WPVELEKCDGRVWICKGWRNFMDYYSIDHGHLIVFRLEGASFFHVLIFDKSATEIEYPQK
PVAPEKLLDPEVVEIDDVSTELGEHIISPRERRELKSPLWSASPEGKGSHSGDRRTLKLK
KNMRAYCSSRDYGGMIYFP
Download sequence
Identical sequences A0A059AKX0
Eucgr.I00406.1|PACid:23594955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]