SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059AZ52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059AZ52
Domain Number 1 Region: 124-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-23
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059AZ52
Sequence length 498
Comment (tr|A0A059AZ52|A0A059AZ52_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW59024.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_H01651 OC=Eucalypteae; Eucalyptus.
Sequence
MAAGQVKTEMQDEGPQATATAPAPEELRNLKLPAEGGVTLALLSPTSASRAKADAGSSSM
VRVRRRKGTILKIKMKDSGSQVVSDRSRKSLSFKKSKTALDGTLDPGEVKSGAMVRAEEV
QSNLEPTYPSFIKALVRSHVGSCFWMGLPGVFCRAHLPNKDTTIVLEDEYGKQYEMKYIA
HKTGLSAGWRQFSVGHNLLEGDVLVFQLVEPNKFKVYIIKAGNLAEVDGALGLLNLDAPS
KKAEAEDGTNHEASARQPRRRRGSSLPLAIVQKRRKKSDQQKSTPNPECLVEQSENDSEG
VNSEVLEGFKLSLPDVQFKDVDSFSNFHIVINGMVVNSELSEDILRKYYELCRSQNVFLH
ENLLKGMNYKLIVGIICETVHVADAVRACKITTTREEFETWDKTLKAFKILGMNVGFVRA
RLKQLVGLAFESEMAMETQKYVESKRNRDCADEEISNLEARLLELKEDNRRVSAEIECLK
PKVESYELKFQEEVTAPW
Download sequence
Identical sequences A0A059AZ52
Eucgr.H01651.1|PACid:23591105 XP_010070338.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]