SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059BBX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059BBX3
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000001
Family B3 DNA binding domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059BBX3
Sequence length 110
Comment (tr|A0A059BBX3|A0A059BBX3_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW63618.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_G01246 OC=Eucalypteae; Eucalyptus.
Sequence
MVIPPSYMNCLSLPVGFIKQHIQENKGMATLRFSGESWPVKLLSYTQTRKILSGYTHDTR
VFFTTGWTAFARETHMRMGNLCVFELIDRDDVVFQVSNFSSAGKEPIPID
Download sequence
Identical sequences A0A059BBX3
Eucgr.G01246.1|PACid:23586860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]