SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059BIM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059BIM3
Domain Number 1 Region: 7-95,176-406
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.42e-83
Family IF2B-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059BIM3
Sequence length 417
Comment (tr|A0A059BIM3|A0A059BIM3_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW65928.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_G03244 OC=Eucalypteae; Eucalyptus.
Sequence
MPDVQALVNEFLFKLKKRKIEGSHATARQTAILLRSVISQQRIPHTHQAAALIDAVKAVG
EQLVAANPVELAVGNIVRRVLHIIREEDLSLTTVAMAGLNVSPVSDDEGETDQDDHPVLS
AAAVAAASRNTLRPPSLQTLLEDLPDSTAIPHTSSSGGDSDGKSKSADKSTRSRKLKHDV
IEALNELIGDIDTCHEQIAEQAVEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFIA
EGAPRYQGHLLAKELVARGLQTTLITDSAVFAMISRVNMVIVGAHAVMANGGVIAPVGLN
MVALAAQRHAVPFVVLAGSHKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCMDFGSGTG
SPLLHVVNPTFDYVPPKLVSLFITDTGGHNPSYVYRLIADYYSNDDLVLQRKPAPTN
Download sequence
Identical sequences A0A059BIM3
XP_010067743.1.83385 XP_018715331.1.83385 Eucgr.G03244.1|PACid:23589093 Eucgr.G03244.2|PACid:23589094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]