SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059C524 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059C524
Domain Number 1 Region: 8-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000647
Family B3 DNA binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059C524
Sequence length 81
Comment (tr|A0A059C524|A0A059C524_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW73573.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_E02128 OC=Eucalypteae; Eucalyptus.
Sequence
MKRARRVKSSKGADVVVWDADTCSEHQLVFAYWASSGSYVLKGCWMKEFVQRRGLAEGDE
IRIHWDPVASKFHFSLLRRAN
Download sequence
Identical sequences A0A059C524
Eucgr.E02128.1|PACid:23578709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]