SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059CBQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059CBQ7
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.15e-48
Family B3 DNA binding domain 0.0054
Further Details:      
 
Weak hits

Sequence:  A0A059CBQ7
Domain Number - Region: 753-824
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0353
Family PB1 domain 0.011
Further Details:      
 
Domain Number - Region: 550-618
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0714
Family WD40-repeat 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059CBQ7
Sequence length 897
Comment (tr|A0A059CBQ7|A0A059CBQ7_EUCGR) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_D00264 OC=Eucalypteae; Eucalyptus.
Sequence
MRLSSAGFSPQAQEGEKRVLNSELWHACAGPLVSLPAIGSRVVYFPQGHSEQVAASTNQE
VDAQIPNYPSLPPQLVCQLHNVTMHADIETDEVYAQMTLQPLSPQEQKEAYLPAELGSPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSLQPPAQELIARDLHDNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGVRRANRPQTVMPSSVL
SCDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVISLAKYIKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGICDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPSYGLRDDDMGIASPSMWLRDGDRGMQSLNFQGMGLTPW
LQPRLDASMLGLQPDMYQAMAAAALQEMRAVDHSKLATASLMPVQHVQNITSASASLMPS
QMLISTQPQQSLLQGSRESPHHSVSQDQVQSHLLQRQLQHQNSFTNQQQPQQEQLRQQLV
NQEQIPSASSPSQFALASQSHTASLQTMPSLCQQLSFSDSTGNPVTSPVVSPLQTLLGSF
TQDGSTHHLNLPRTNSSVSPSSWPSKRAAIESLVPSGPSQRVLPQMDQLGPPQNNLSPSS
VSLPPFPGRECLDQEVTDVQSHLLFGVNLEPSSLLMQNGISSLRAVGSESDSTSMPFPSN
YISNSGADFAPNPSVAPPGGIDDSGFLQSPENLNQVNVPTRTFVKVYKSGSFGRSLDITK
FSSYNELRSELARMFSLEGQLEDPVRSGWQLVFVDRENDSLLLGDGPWPEFVNSVWCIKI
LSPQEVQQMGKQDLELLNSIPVQRHSNGGCDEFTNRQDSRTINSGIPSVGSLDYGTL
Download sequence
Identical sequences A0A059CBQ7
XP_010052021.1.83385 Eucgr.D00264.1|PACid:23574027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]