SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059CH55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059CH55
Domain Number 1 Region: 66-252
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.99e-45
Family FAD-linked oxidases, N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059CH55
Sequence length 541
Comment (tr|A0A059CH55|A0A059CH55_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW77265.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_D01622 OC=Eucalypteae; Eucalyptus.
Sequence
MSPSIHSALSLILLLLISHSCLISVSSTIQDDFVQCLNLNSELVVPLSTFYNQKSSNFSA
VLQSSAQNLRYLVPSMPKPEFIFTPLIEGHVQAAVICSKQLGIHLRVRSGGHDYEGLSYV
SETLTPFIIVDLSRLRSVTVDLADNTAWAQAGATIGEVYYRIAEKSRIHGFPAGLCTSLG
VGGHITGGAYGSMMRKYGLGVDNVLDARIVDVNGRILDRAAMGEDLFWAIRGGGGASFGI
ILEWKIKLVPVPSMVTVFTVTKTLEQGATKLLHRWQQVVDTLDEDLFIRVIIQAASAGGG
KANRTVSTSYNALFLGTADRLLKVMEDSFPELGLMRSDCFEMSWIRSVLYIAGYPSGTPP
EVLLKGKSTFKNFFKAKSDFVRDTISETGLEGLWMRLVQEDSPLMIWTPYGGMMSKISES
SAPFPHRKGTIFMIQYLSLWNDESEDATKHMNWIRRLYSYMAPYVSMFPRETYVNYRDLD
LGMNKNGTSFIQTVVWGAKYFKDNFDRLVQVKTKVDPDNFFRHEQSIPPLPLSLRGKWTT
D
Download sequence
Identical sequences A0A059CH55
Eucgr.D01622.1|PACid:23575372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]