SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059D7A5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059D7A5
Domain Number 1 Region: 195-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.45e-30
Family B3 DNA binding domain 0.00000802
Further Details:      
 
Domain Number 2 Region: 65-121
Classification Level Classification E-value
Superfamily DNA-binding domain 2.94e-17
Family GCC-box binding domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059D7A5
Sequence length 364
Comment (tr|A0A059D7A5|A0A059D7A5_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW86364.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_B03048 OC=Eucalypteae; Eucalyptus.
Sequence
MDGNSSCIDELSSTSDSVCVPPPSKSSPPPLPPPPQSLCRHGSGTSVIVDSEGCVEAESR
KLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAAMAYDVAAQRFRGGDAVTNF
KRKSEAEDYDLEAAFLSAHSKPEIVDMLRKHTYRDELEQSKRKCLNSNGGGKRASMTEVL
GDLSSPGGIAMVRQLLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLRNGTSSATSKGVLLN
FEDSGGKVWRFRYSYWNSSQSYVLTRGWSRFVKEKGLTAGDIVSFHQSAGPEKQLHIGYR
RRSSLGGSGPVLPVQMVRLFGVNIFKVSAAGGGDDTGDWSGKRMREVELLSLGCNKKQMV
IGAL
Download sequence
Identical sequences A0A059D7A5
Eucgr.B03048.1|PACid:23568281 XP_010044293.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]