SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059D7B1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059D7B1
Domain Number 1 Region: 26-127
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000131
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059D7B1
Sequence length 130
Comment (tr|A0A059D7B1|A0A059D7B1_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW86110.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_B02808 OC=Eucalypteae; Eucalyptus.
Sequence
MLASRSSTSKRSKKVTTALKGANEDELQCPSFTVVIRSHNLLKQNVTVPGGILREHINGS
MQTATLKYRDGSWPVKLLYYPQHGSGKLLAGWASFHRGTYLKEGDVCLFELVRIDNVELK
VSNFRRNAKI
Download sequence
Identical sequences A0A059D7B1
Eucgr.B02808.1|PACid:23568029 XP_018724504.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]