SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059UUY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059UUY0
Domain Number 1 Region: 27-285
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.59e-86
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059UUY0
Sequence length 297
Comment (tr|A0A059UUY0|A0A059UUY0_PSEPU) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta {ECO:0000256|HAMAP-Rule:MF_01395} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=DW66_1872 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSNWLVDKLIPSIMRSEVKKSSVPEGLWHKCPACEAVLYRPELEKTLDVCPKCNHHMRIG
ARARIDIFLDADGRAELGADLEPVDRLKFRDGKKYKDRLAGAQKQTGEKDALISMSGTLM
GMPIVVSAFEFSFMGGSMGAIVGERFVRAANYALEHRCPMVCFSASGGARMQEALISLMQ
MAKTSAVLARLREEGIPFISVLTDPVYGGVSASLAMLGDVIVGEPKALIGFAGPRVIEQT
VREKLPEGFQRSEFLLEHGAIDLIISRGELRPRLARLLAQMTGQETPEQAREAAAVA
Download sequence
Identical sequences A0A059UUY0 A0A0B5KEW1 A0A0C1KNZ6 A0A136QM21 F8FS88 L0FGN2 V7D821 V9UWY8
gi|568180999|ref|YP_008953533.1| gi|568186430|ref|YP_008958962.1| 2035990212 gi|339486510|ref|YP_004701038.1| gi|431801487|ref|YP_007228390.1| WP_013971609.1.23948 WP_013971609.1.28354 WP_013971609.1.35335 WP_013971609.1.56258 WP_013971609.1.57632 WP_013971609.1.65739 WP_013971609.1.71677 WP_013971609.1.7435 WP_013971609.1.80759 WP_013971609.1.95946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]