SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059V685 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059V685
Domain Number 1 Region: 3-182
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.9e-38
Family Phosphoglucomutase, first 3 domains 0.000000692
Further Details:      
 
Domain Number 2 Region: 158-260
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.83e-34
Family Phosphoglucomutase, first 3 domains 0.00000292
Further Details:      
 
Domain Number 3 Region: 263-369
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 9.42e-34
Family Phosphoglucomutase, first 3 domains 0.00000405
Further Details:      
 
Domain Number 4 Region: 372-465
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 5.06e-25
Family Phosphoglucomutase, C-terminal domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A059V685
Sequence length 466
Comment (tr|A0A059V685|A0A059V685_PSEPU) Phosphomannomutase {ECO:0000313|EMBL:AHZ80204.1} KW=Complete proteome OX=303 OS=Pseudomonas putida (Arthrobacter siderocapsulatus). GN=DW66_5708 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MNDMAHLVPAALPDSIFRAYDIRGVVGKTLHAETAYWIGRAIGAQSLAQGEPQVSVGRDG
RLSGPMLVEQLIKGLVDAGCQVSDVGLVPTPALYYAANVLAGKSGVMLTGSHNPSDYNGF
KIVIAGDTLANEQIQALLTRLKTNDLTLAEGRVEKVEILDRYFQQIVEDVKLAKKLKVVV
DCGNGAAGVVAPQLIEALGCEVIPLFCEVDGNFPNHHPDPGKPENLEDLIAKVKETGADI
GLAFDGDGDRVGVVTNTGSIVYPDRLLMLFAQDVLSRNPGAEIIFDVKCTRRLTPLIEQH
GGRALMWKTGHSLIKKKMKQTGSLLAGEMSGHIFIKERWYGFDDGIYSAARLLEILSKAG
KSAENLFAAFPNDISTPEINIDVTDEGKFSIIDALQRDADWGEANLTTIDGVRVDYAHGW
GLVRASNTTPVLVLRFEADSDAELQRIKDVFRTQLLRVEPELQLPF
Download sequence
Identical sequences A0A059V685 V9V4W0
WP_024087915.1.1643 WP_024087915.1.23948 WP_024087915.1.28354 WP_024087915.1.35335 WP_024087915.1.95946 gi|568190007|ref|YP_008962700.1| gi|568184634|ref|YP_008957337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]