SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A060ZQB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060ZQB1
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-78
Family Protein kinases, catalytic subunit 0.000000031
Further Details:      
 
Domain Number 2 Region: 517-578
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 452-511
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000301
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060ZQB1
Sequence length 672
Comment (tr|A0A060ZQB1|A0A060ZQB1_9ACTN) Serine/threonine protein kinase with PASTAsensor(S) {ECO:0000313|EMBL:CDR08377.1} OX=576784 OS=Streptomyces iranensis. GN=SIRAN5048 OC=Streptomyces.
Sequence
MEEPRRLGGRYELGSVLGRGGMAEVYLAHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDGVSIPYIVMEYVDGSTLRELLHSGRKLLPERSLEMTT
GILQALEYSHRNNIVHRDIKPANVMLTRDGQVKVMDFGIARAMGDAGMTMTQTAAVIGTA
QYLSPEQAKGETVDARSDLYSTGCLLYELLTVRPPFVGDSPVAVAYQHVREEPQPPSTYD
PEITPEMDAIVLRALVKDPDYRYQSADEMRADIEAALEGQPVAATAALGAVGYGSDDQPT
AMLRPQNSGAGAQTSMLPPMRDDDGGFGYDERPDRGRGRGGPGKKSNLSTILLIIAGILV
LVGAIFIGKSLFAGGKNDDMVRVPNLVGKTLEDAKSQGENGDFKVKNVGSKFCENADKNT
VCEQTPKGGDEVKRYGTVELTMSKGPKPAARVEVPDVLNVQYESAKQQLEAKGFNVDQKT
EQSDQTAGKVIDQDPKGGKKVAKGATITLTVAEAQQKVVVPDVTTQKVEDATKSLQGKGL
KVQTQEVESGDVEAGTVTDQTPKGGQEVLPGSTVTLTVAKEPAQGENVPVPNLGGQKLKD
AKKALQDLGLNVGNIAGPQDDNASVVASQPGAGTQVPKGQSVNLITVAGQGGNGGNGGGD
NGGGIFGGQNGF
Download sequence
Identical sequences A0A060ZQB1
WP_044572543.1.55263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]