SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A061EML0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061EML0
Domain Number 1 Region: 167-506
Classification Level Classification E-value
Superfamily ARM repeat 1.15e-55
Family Armadillo repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 529-631
Classification Level Classification E-value
Superfamily POZ domain 5.34e-30
Family BTB/POZ domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061EML0
Sequence length 704
Comment (tr|A0A061EML0|A0A061EML0_THECC) ARM repeat protein interacting with ABF2 isoform 1 {ECO:0000313|EMBL:EOY05612.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_020571 OC=Theobroma.
Sequence
MELQRSQDQGLPERKGQKRKLEEENQEDRETSLPTGDARRALLAEVTAQVSVLDSTFSWR
EPDRAAAKRATHVLAELAKNEEVVNVIVEGGAVPALVKHLQAPPCSDGDRSPKPFEHEVE
KGSAFALGLLAVKPEHQQLIVDSGALSHLVNLLRRHKDGSTSRAVISVIRRAADAITNLA
HENSSIKTRVRMEGGIPPLVELLDFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPS
LILMLRSEDAAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLTSCCSESQREAAL
LLGQFAATDSDCKVHIVQRGAVRPLIDMLHSPDVQLKEMSAFALGRLAQDTHNQAGIAHN
GGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVSDFIMVGGVQRLQDGEFIVQATKDC
VAKTLKRLEEKIHGRVLNHLLYLMRVAEKPVQRRVALALAHLCSPEDQRTIFIDNNGLEL
LLGLLGSTSPKQQLDGAVALYKLANKAMSLSPMDAAPPSPTPQVYLGEQYVNNATLSDVT
FLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSV
DVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCIL
FILENFDKLSTRPGHLHLIQRIIPEIRNYFAKALTKPNPHNLRL
Download sequence
Identical sequences A0A061EML0
Tc04_g023340 XP_007034686.1.67643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]