SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A063YM34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063YM34
Domain Number 1 Region: 19-235
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000217
Family G proteins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063YM34
Sequence length 492
Comment (tr|A0A063YM34|A0A063YM34_9BACI) Coat morphogenetic protein SpoIVA {ECO:0000256|PIRNR:PIRNR007466} KW=Complete proteome; Reference proteome OX=1482738 OS=Geobacillus sp. CAMR12739. GN=DI43_11305 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MEKVDIFKDIAERTGGDIYLGVVGAVRTGKSTFIKRFMELVVIPNIKNEADKARAQDELP
QSAAGKTIMTTEPKFVPNQAVTVKVDEGLEVNIRLVDCVGYAVPGAKGYEDENGPRMIHT
PWYEEPIPFQEAAEIGTRKVIQEHSTIGVVITTDGTIGEIPRQDYVEAEERVISELKEVG
KPFIMIVNTVRPHHPETEALRRELAEKYDIPVLAMSVESMREADVYNVLREALYEFPVLE
VNVNLPSWVMVLREDHWLRESYQEAVRDTVKDIKRLRDVDRVVQQFAEYDFIEKAALAGI
EMGQGIAEIDLYAPDELYDQILKEIVGVEIRGKDHLLQLMQDFAHAKAEYDQIADALKMV
KQTGYGIAAPALSDMSLDEPEIIRQGSRFGVRLKAVAPSIHMIKVDVESEFAPIIGTEKQ
SEELVRYLMQDFEDDPLSIWNSDIFGRSLSSIVREGIQAKLALMPENARYKLKETLERII
NEGSGGLIAIIL
Download sequence
Identical sequences A0A063YM34 A0A063YS00 A0A098L0W9 A0A0D8BSP1 A0A0E0TD42 A0A142D1V7 A0A1C3D274 A0A1V9C5E9 G8MZN6 L8A149 Q5KXT4 S7TXC6 T0NM87 U2Y754 V6VB95
gi|448238509|ref|YP_007402567.1| gi|56420752|ref|YP_148070.1| gi|319767242|ref|YP_004132743.1| 235909.GK2217 544556.GYMC61_0464 gi|261417946|ref|YP_003251628.1| gi|375009274|ref|YP_004982907.1| gi|297529614|ref|YP_003670889.1| WP_011231701.1.100150 WP_011231701.1.13089 WP_011231701.1.17728 WP_011231701.1.19233 WP_011231701.1.20723 WP_011231701.1.2219 WP_011231701.1.22479 WP_011231701.1.25743 WP_011231701.1.38260 WP_011231701.1.38928 WP_011231701.1.45808 WP_011231701.1.46340 WP_011231701.1.50933 WP_011231701.1.60903 WP_011231701.1.6497 WP_011231701.1.70239 WP_011231701.1.78869 WP_011231701.1.80994 WP_011231701.1.8599 WP_011231701.1.90668 WP_011231701.1.91533 WP_011231701.1.92435 WP_011231701.1.93593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]