SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A063YPU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063YPU8
Domain Number 1 Region: 4-230
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-61
Family ABC transporter ATPase domain-like 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A063YPU8
Sequence length 304
Comment (tr|A0A063YPU8|A0A063YPU8_9BACI) ABC transporter ATP-binding protein {ECO:0000313|EMBL:KDE47814.1} KW=Complete proteome; Reference proteome OX=1482738 OS=Geobacillus sp. CAMR12739. GN=DI43_07725 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MTKQVTLAVKELRKTIRGKEIIKGISFELHEGEVFGFLGPNGAGKTTTIRMLVGLIRPTS
GTVAICGYDLHRQFTDAIRQIGCIVENPEMYPYLTGWENLEHFARMMPGIGADRIMEVAK
LVGLEQRIHDRVGTYSLGMRQRLGIAQALLGKPKVLILDEPTNGLDPAGIREMRAFIRFL
AETEGLSVLVSSHLLSEIQLMCDRVAIMAKGRLLAVDTVERLLNQQARVVWKAAPTDRAR
ALLAAETEVLRADEETIVTPYEPSRLAAWNAKLVQAGVSVSEIEPRLPTLEDLFIELTGG
ETIE
Download sequence
Identical sequences A0A063YPU8 A0A063YUX7 A0A098L2I5 A0A1C3D7L1 A0A1Q5SJX5 A0A1V4P4P8 A0A1V9BUH3 G8N5D9 Q5KZF8 T0NVK3 V6V896
gi|56420178|ref|YP_147496.1| gi|375008680|ref|YP_004982313.1| 235909.GK1643 WP_011231138.1.100150 WP_011231138.1.19233 WP_011231138.1.20723 WP_011231138.1.2219 WP_011231138.1.22479 WP_011231138.1.25743 WP_011231138.1.3446 WP_011231138.1.45808 WP_011231138.1.60903 WP_011231138.1.6497 WP_011231138.1.70239 WP_011231138.1.77642 WP_011231138.1.78869 WP_011231138.1.8599 WP_011231138.1.90668 WP_011231138.1.91533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]