SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A063YRB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A063YRB2
Domain Number 1 Region: 112-278
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.36e-37
Family Nitrogenase iron protein-like 0.089
Further Details:      
 
Weak hits

Sequence:  A0A063YRB2
Domain Number - Region: 12-67
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000341
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A063YRB2
Sequence length 320
Comment (tr|A0A063YRB2|A0A063YRB2_9BACI) Phosphate starvation protein PhoH {ECO:0000313|EMBL:KDE47690.1} KW=Complete proteome OX=1482739 OS=Geobacillus sp. CAMR5420. GN=DI44_12575 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MSEQFVTISQHVRNPQEAAALFGVHDIHLKRIEEELGVSIVTRGETVNVSGTPQQVQLVD
ELLRHLLIVIRKGAAVSERDVLYAIQLAKKGALDGLVQLYDEEITKNAKGKPIRVKTLGQ
RYYVAAIEQYDLTFGIGPAGTGKTYLAVVMAVKALKNGSVKRIILTRPAVEAGESLGFLP
GDLKEKVDPYLRPLYDALNDVLGAEYTQRLIERGTIEIAPLAYMRGRTLEDAFVILDEAQ
NTTPAQMKMFLTRLGFGSKMVITGDISQVDLPKGVESGLSVAKRILASIGGIAFVFLEQS
DVVRHPLVAKIIDAYDEAGL
Download sequence
Identical sequences A0A063YRB2 A0A098L036 A0A0J0YTJ0 A0A142D2H0 A0A1D7NDI4 A0A1Q5STH8 A0A1V4P602 A0A1V9BWR7 A0A2H5KL24 G8N2S1 L8A0P5 Q5KX08 T0PYI7 U2X1T5 V6V9F3
gi|375009580|ref|YP_004983213.1| gi|297529341|ref|YP_003670616.1| 235909.GK2493 gi|448238772|ref|YP_007402830.1| WP_011231973.1.100150 WP_011231973.1.17728 WP_011231973.1.19233 WP_011231973.1.20723 WP_011231973.1.2219 WP_011231973.1.25743 WP_011231973.1.3446 WP_011231973.1.38928 WP_011231973.1.45808 WP_011231973.1.46340 WP_011231973.1.57889 WP_011231973.1.60903 WP_011231973.1.6497 WP_011231973.1.65208 WP_011231973.1.70239 WP_011231973.1.77642 WP_011231973.1.78869 WP_011231973.1.8599 WP_011231973.1.86012 WP_011231973.1.90668 WP_011231973.1.91533 WP_011231973.1.92435 WP_011231973.1.93593 gi|56421028|ref|YP_148346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]