SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DAG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DAG5
Domain Number 1 Region: 249-359
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.8e-17
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 46-173
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000188
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067DAG5
Sequence length 574
Comment (tr|A0A067DAG5|A0A067DAG5_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO39823.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g008204mg OC=Citrus.
Sequence
MENANEKSASLSFVSSYPTCWSTNQSTGPFDLDTLNLRRQSSNPEEPLLDAEIVVDGKSV
AVNRSILSARSRFFHWLFHLSSDGSVSEGKPKYLMTDLVPYRKVGYEAFNDILHYLYTGM
RKAPPSEVFTCVDDTCVHLVCPPAINYVIESIYASAAFKMTEVVSVYEGWLLKVVREALV
EDVIPILVAALQCQLYPLCSFCIQRIARSNIDNVCLEKELPDEVSSEIKSLRVKSNQESE
ANIKEVDPMHEKRVRRIHKALDSDDFELLNLLLNEYKVTLDDACALHYAAAYCNPKVFKE
VHNMGLADINLKDARGRTVLHVAARRKEPEVMVVLLSKGACSSETTPDGQTAVAICRRMT
RRKDYIEATKQGQETNKDWLCIDVLERDMTTNSTSGNLAMSSEVIDDVFQMNLDYLENRG
ADIAIGLSALGRKRLSGNLKEVDLNETPSKQAKRCQLRLLTLLKTVETGQRYFPHCSDVV
DKFRYCNRPHCLELVDEFLDCDWSDASLLEKGTPEERKLKRAGFMKLEADMQEALRKDVA
YHRCSGLPSSWSALYKYLAESNRSGMPTSSAASN
Download sequence
Identical sequences A0A067DAG5
orange1.1g008204m|PACid:18129637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]