SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DKY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DKY4
Domain Number 1 Region: 218-320
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000041
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 13-84,140-169
Classification Level Classification E-value
Superfamily POZ domain 0.00000000105
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067DKY4
Sequence length 381
Comment (tr|A0A067DKY4|A0A067DKY4_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO39256.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g045501mg OC=Citrus.
Sequence
MQSTNPKETWLEAEIVVEGKSVAVNRSVLSELSQFFRRLFNLRNDGSVSEGKPKYLLTDL
VPHGKVGYEAFNDILHRLYTGKLKAPPPEVSACVDDACSHDACPPAINYAIELMYASAAF
QMKELVFLLQLWLRSMVEKALVENVIPILVAALHCQLNQLRSVCIQRIAKSNLDNVCLEK
ELPDEVSSEIKSLRVKSNQESEANTKEVDPLREKTVRRIHKALDTDDFELLTLLLDVSNV
TLDDAYALHYAAAYCNPKVFKEVLNMDLAGLNLKDARGRTVLHVAARRNEPEVMVTLLSK
GACASETTSDWQTAVAICRRVTRRKDYLEATKQGQETNKDQLCIDVLEREMRRHSMSENL
AMSSEVMDDDFQRKLNYLEKK
Download sequence
Identical sequences A0A067DKY4
orange1.1g045501m|PACid:18095009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]