SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DP69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DP69
Domain Number 1 Region: 208-311
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-17
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  A0A067DP69
Domain Number - Region: 56-74,130-157
Classification Level Classification E-value
Superfamily POZ domain 0.00513
Family Tetramerization domain of potassium channels 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067DP69
Sequence length 415
Comment (tr|A0A067DP69|A0A067DP69_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO40807.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g014994mg OC=Citrus.
Sequence
MLRLLLRANQWRLIAAYCLSAVKFFRRLLNLRNDGSVSEGKPKYLLTDLVPCDGKFGFEA
FNDILHYIYTGKLKAPPPEVSACVDDACVHVSCPSSVNYVIELMYASAALQMKDRVFLLQ
HWLLGMVGKALVEDVLPILVAAFHCQLNMLRSYCIQRIAGSNLDNFCLERELPDEVSSEI
KSLRVKSNQESEANIAEVDPMHAKIVRRIHKALHSDDVELLKLLLDVSNVTLDDAYALHY
AAACCSPKVFKEVLNMDSAGLNLKDARGRTVLHVAARRNEPEVMVTLLSKGARASETTSD
GQTAVAICRRMTRRKDYIEASKQGQETNKDRLCIDVLEREMRRNSMSRFPPKKFLDCDWS
DAYLLENGTPEEQNRKRARFMELKEVQKAFYKDMAEKIVQVCRHPRRRHLLQRKE
Download sequence
Identical sequences A0A067DP69
orange1.1g014994m|PACid:18117838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]