SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DQD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DQD1
Domain Number 1 Region: 240-350
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.33e-17
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 40-113,169-198
Classification Level Classification E-value
Superfamily POZ domain 0.000000000732
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067DQD1
Sequence length 427
Comment (tr|A0A067DQD1|A0A067DQD1_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO40806.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g007758mg OC=Citrus.
Sequence
METANEKSASLSFLSSYPTCWSTNQSTGPEICSDPGEPWLDAEIVVEGKSVVVNRSILSE
RSQFFHRLFNLRNDGSVSEGKPKYLLTDLVPHGKVGFEAFNDILLYLYTGMTKESPPEVS
ACVDDACVHVSCPPTINYAVELIYACAAFQITELVSYFQCLLLILAENAPVEDVIPILVA
ALHCQLNRLHSCCIQRIARSNLDNVCLEKELPDEVSSEIKSLRVKSNQESEANIKEVDPM
HEKRVRRIHKALDSDDFELLNLLLNEYEVTLDDAFALHYAAAYCNPKVFKEVLNMGLADL
NLKDARGRTVLHVAARRKEPAVLETLLSKGACASETTSDGRTAVAICRRMTRRKDYIEAS
KQGQETNKDWLCIAFLEREIRRNSMSGNLAMSADVMGDAFQMKLDYLEKKGDIYFLVLVH
CLLIVFA
Download sequence
Identical sequences A0A067DQD1
orange1.1g014273m|PACid:18117841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]