SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DT65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DT65
Domain Number 1 Region: 268-379
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.57e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 48-193
Classification Level Classification E-value
Superfamily POZ domain 3.45e-16
Family BTB/POZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067DT65
Sequence length 599
Comment (tr|A0A067DT65|A0A067DT65_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO44755.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g007550mg OC=Citrus.
Sequence
MVLDSIMENANEMSSSLSFASSSYLSNGSTNHPASPELCSSLDNLSLSKLSSNLEKLLLD
AEHDYTDADIVVEGKSVAVHRCILSARSQFFHELFKKGNDNDGSAVSEGKPKYLMTELVP
YGKVGYEAFNVILYYFYTGKLKPSPSEVSTCVDDACAHDACPPAINYAIELMYASAAFQM
KELVLLFQRRLLNFVEKALVEDVIPILVAAFHCQLNQLRSHCVQRVVRSNLDDVCLEKEL
PDEVSGEIKSLRVKSDEECEANIAEVDPMHAKRVRRIHKALDSDDVELLKLLLDESNVTL
DDAYALHYAAAYCNPKVFKEVLNMGLADLNLKNARGHTVLHVAARRKEPAVLVTLLSKGA
CASETTSDGQTAVAICRRMTRRKDYIEATKQGQETNKDRLCIDVLEREMRRNSMSGNLAL
SSEVMADDFQMKLNYLENRVAFARLLFPSEARVAMHIADADATNFYTGLSASKSKGSSGN
LKEVDLNETPSMQAKRLQLRLQALLKTVETGRRYFPHCSDVVDKFLDCDWSDASLLENGT
PEEQRLKRARFMELKEDVQKAFYKDMAEKNRSGLSSSSSSSSSPKEGVKCKGRKSVMIR
Download sequence
Identical sequences A0A067DT65
orange1.1g007550m|PACid:18110700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]