SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DV50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DV50
Domain Number 1 Region: 263-368
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.6e-17
Family Ankyrin repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 50-186
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000424
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067DV50
Sequence length 585
Comment (tr|A0A067DV50|A0A067DV50_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO45450.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g007923mg OC=Citrus.
Sequence
MDNRNGFSDSNEISNNSRTSCVAAAANTESFYSSEPVNSDITALRILSKTLETIFESQDF
DYFTDAKIVLSTGREVPVHRCILSSRSGFFKNVFAGTGKQRGPKFELKELVRDYEVGFDP
LVAVLAYLYCGKVRPFPIGVCVCVDDDACSHVACRPAVDFMVEVLYVSFAFQVPELVALY
QRHLLDILDKVVADDILVVLSVAHMCGKACEKLLERCIEITVKSDIDIVTLDKTLPQHIV
KQIIDLRVELSLHRSESCGFPDKHTKRIHRALDSDDVELVRMLLKEAHTNLDDAHALHYA
VAYCDAKTTTELLDLGLADVNHRNSRGYTVLHVAAMRKEPKIIVSLLTKGARPSDLTLDG
RKALQISKRLTKAADYYIPTEEGKTTPKDRLCIEILEQAERRDPLLREASHSFAMAGDDL
RMKLLYLENRVGLAKLLFPMEAKVIMDIVHLDGTLEFALDGIKTKKMAGAQRTTVDLNEA
PFKMQEEHLNRMKALCRTVELGKRFFPRCSEVLNKIMDADDLNQLACPGNDTPEERLLKR
IRYMELQEVVSKAFNEDKEEFDRSAISSSSSSKSVVRPRGGKRTH
Download sequence
Identical sequences A0A067DV50 V4UKH6
clementine0.9_005813m|PACid:19254919 orange1.1g007923m|PACid:18117481 XP_006451500.1.91645 XP_006475479.1.29302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]