SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067DXM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067DXM9
Domain Number 1 Region: 87-344
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000213
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 2 Region: 301-472
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000183
Family Tropomyosin 0.002
Further Details:      
 
Weak hits

Sequence:  A0A067DXM9
Domain Number - Region: 634-708
Classification Level Classification E-value
Superfamily HRDC-like 0.0872
Family RNA polymerase II subunit RBP4 (RpoF) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067DXM9
Sequence length 1046
Comment (tr|A0A067DXM9|A0A067DXM9_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO46355.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g001522mg OC=Citrus.
Sequence
MKNCDNNKEELRLAESKKEILRRSYDLAHAQANSVLNFTVQWKDLEEHLDISMKSLEKQS
NDADSKIRLLDQRAKEIESKESDLVLAERRIKECNFELACKEKQLELVRKRIGECECELQ
LKEGELNLVKKSVEEWLEKLDLKMKEVGLVEKSNDKSLVDQRRLENLIKDFCEQIELKEK
DLRKIRSSIEECEKELVMKEKHASSLQSLIEDYAEELESKEKLYDEIKKSIIQCETKLDC
KKKELELTQTSIIELSLELHLEEEKLESLQRIVRLRENELDSKEEKLDAMKEEMKKYFND
IELKEREFNGIRKCIEKRSQELTLKEKQLKCVQESLEGCRNEFEEKENELISVEKLIDKC
SEELELKKKHLCVIENSAAELSDECESNELELDLIQTMAIGYLKQLKEKEKQFHSLKEAL
DERWQDLEIKERKFEERVKEFELREKEIESIRKAVEDRSKNLELKEKKLSNNLHLQVKIE
QPESLKGNEGTKQLSLQSCTMITGKNLQLLLNQHLQKHDLVFGEISHTLTKACDPASLVL
DAMEGFYPPHSREGDMEFDVSIIRRTCILLLEQLSSVTPEINPQVRDEAMKVAGEWKKKM
RVAEDNSLEVLGFLHLLAAYGLGPSFDGIELESLLDIVAQHRQTSKLRQSLGFAEKAHGL
QCSTTREARSCLSLLNKHDLGHNEVLQLLHLAPDPAMFVLDFIQHWKSQGTGFEEDNVKC
CILVLEKLKEVLPIMNPRVKGEAMKLAVEWKTKMGVGTLNSLEVLVFLQLLGTFELVASF
NRVEIVELLWTISEHKQAPETCRALGFTDIVATIRFICAFKLTDIAKPEAIFKQYLDDNI
SDIHRKGNNSSDAKVKAMDFEVNALTFLIECFKENKLESSLLIENIKQRIVQLEMAKADC
RRHSTPAPSATIQLQLASRNNYNIGTSTPTNQPVPSHTNQPQHSGINHSIGFSASREQPQ
LQNNYKRPRIEPLTTRAYMPQIPASVNLHRSSPTMQHGPGVALSGGQMQFDHIASNHLRV
RANMGAGQTSNVTGNQNLHHFQYKYF
Download sequence
Identical sequences A0A067DXM9
orange1.1g001601m|PACid:18117067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]