SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067EGL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067EGL8
Domain Number 1 Region: 93-196
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000155
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067EGL8
Sequence length 205
Comment (tr|A0A067EGL8|A0A067EGL8_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO50071.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g045464mg OC=Citrus.
Sequence
MAQELNGEAANGESFERFLREAGEEAKGDEILKFFLQSWRLVRDLVGKRVAEVATLMETE
ERVVNVEMLYMPESLKNRIIQEENGKDVVLVMSKKIGKTDLNKNDNRLLIPWGNLRDYSF
LNQEEKTILDSQKGAKKGIEVSVIPPSLESNVKLKLKKWKTGYCLTEKWHSLVVNNQENG
LEMGVTVNLWSFRNNSSELCFALQK
Download sequence
Identical sequences A0A067EGL8
orange1.1g045464m|PACid:18104452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]