SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067EQ72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067EQ72
Domain Number 1 Region: 113-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-40
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 660-738
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000177
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067EQ72
Sequence length 784
Comment (tr|A0A067EQ72|A0A067EQ72_CITSI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g003544mg OC=Citrus.
Sequence
MKLSTSGLCQQGHEGDNKCLNSELWHACAGPLVSLPTVGTRVVYFPQGHSEQVAATTNKE
VDSHIPNYPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPEEQKDTFVPIELGIPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFICDSMHIGLLAAAAHAAATNSCFTVFF
NPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRW
SNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHPSTSSFNDN
RDETASGLNWLRGGTGEQGLTTLNFQSLGMFPWMQQRVEPSFLGNDHNQQYQAMLAAGMQ
SGDPVRQQFMQLQQPFQYLQQSGSQNPLQLKQQQHLLQQLNSQAEDRAQQQQQPQQHMYH
DALQIRTDELLQRQQSNLPSPSFSKANFMDSSTEISVSISPMQNMLGSLPEGSGNLLNFS
GAGPSMLRQQFPQQSLGSKYEPSQVRDFVHSMSLPSSYNGKDAAVGTENCNTDSQNSVVF
GVHIDSSGLLLPTTVSSFTTSVDPGVSSMPLGDSGFHNSMYGCMQDSSELLHNVGQIDQL
TPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRE
NDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGNCGRDPVG
SLEY
Download sequence
Identical sequences A0A067EQ72
orange1.1g003949m|PACid:18123279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]