SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067F1F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067F1F8
Domain Number 1 Region: 30-173
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-48
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 2 Region: 604-682
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000162
Family PB1 domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067F1F8
Sequence length 728
Comment (tr|A0A067F1F8|A0A067F1F8_CITSI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g003544mg OC=Citrus.
Sequence
MHADVETDEVYAQMTLQPLSPEEQKDTFVPIELGIPSKQPTNYFCKTLTASDTSTHGGFS
VPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAK
RLVAGDSVLFIWNEKNQLLLGIRRAIRPPTVMPSSVLSSDSMHIGLLAAAAHAAATNSCF
TVFFNPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLD
PVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHPSTSS
FNDNRDETASGLNWLRGGTGEQGLTTLNFQSLGMFPWMQQRVEPSFLGNDHNQQYQAMLA
AGMQSGDPVRQQFMQLQQPFQYLQQSGSQNPLQLKQQQHLLQQLNSQAEDRAQQQQQPQQ
HMYHDALQIRTDELLQRQQSNLPSPSFSKANFMDSSTEISVSISPMQNMLGSLPEGSGNL
LNFSGAGPSMLRQQFPQQSLGSKYEPSQVRDFVHSMSLPSSYNGKDAAVGTENCNTDSQN
SVVFGVHIDSSGLLLPTTVSSFTTSVDPGVSSMPLGDSGFHNSMYGCMQDSSELLHNVGQ
IDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVF
VDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGNCGR
DPVGSLEY
Download sequence
Identical sequences A0A067F1F8
orange1.1g004820m|PACid:18123283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]