SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067F7Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067F7Q6
Domain Number 1 Region: 101-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 745-827
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000319
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067F7Q6
Sequence length 886
Comment (tr|A0A067F7Q6|A0A067F7Q6_CITSI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g002390mg OC=Citrus.
Sequence
MRLATSGFNQQTQEGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKE
VDAHIPNYPNLPPQLICQLHNLTMHADVETDEQEQKDVYLLPAELGAPNKQPTNYFCKTL
TASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKFRHIFRGQPKRHL
LTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSVLSSDSMHIGLLA
AAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRR
YMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYSSPFPL
RLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQGYGVTPWMQPRLDAS
IPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGTASMIPRQMLQQSQA
QNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQLHQLSVQPQISNVIS
TLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHTILGSLSQAGASHLL
NSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSNVSELASLLPPFPGR
EYSSYHGSGDPQNNLLFGVSIDSSLMGQNGLPNLKNISSENESLSLPYAASNFTNNVGTD
FPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFGRSLDISKFSSYDELR
SELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQEFVNNVGYIKILSPLEVQQ
MGKGLSPVTSGPGQRLSSNNNFDDYVSRQELRSSSNGVASMGSINY
Download sequence
Identical sequences A0A067F7Q6
orange1.1g002737m|PACid:18127409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]