SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067FB93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067FB93
Domain Number 1 Region: 113-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.05e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 757-833
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000388
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067FB93
Sequence length 833
Comment (tr|A0A067FB93|A0A067FB93_CITSI) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g002390mg OC=Citrus.
Sequence
MRLATSGFNQQTQEGEKKCLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKE
VDAHIPNYPNLPPQLICQLHNLTMHADVETDEVYAQMTLQPLSPQEQKDVYLLPAELGAP
NKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQTPPAQELIARDLHDNEWKF
RHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRATRPQTVMPSSV
LSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFR
MLFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPL
TTFPMYSSPFPLRLKRPWPSGLPSFHGMKDGDMSINSPLMWLQGGVGDQGIQSLNFQGYG
VTPWMQPRLDASIPGLQPDVYQAMAAAALQEMRTVDSSKLASQSLLQFQQSQNVSNGTAS
MIPRQMLQQSQAQNALLQSFQENQASAQAQLLQQQLQRQHSYNEQRQQQQQVQQSQQLHQ
LSVQPQISNVISTLPHLASSSQSQPPTLQTVASQCQQSNFSDSLGNPIASSDVSSMHTIL
GSLSQAGASHLLNSNASNPIISSSAMLTKQVTVDNHVPSAVSHCILPQVEQLGAQQSNVS
ELASLLPPFPGREYSSYHGSGDPQNNLLFGVSIDSSLMGQNGLPNLKNISSENESLSLPY
AASNFTNNVGTDFPLNSDMTTSSCVDESGFLQSSENVDQVNPPTRTFVKVHKSGSFGRSL
DISKFSSYDELRSELARMFGLEGQLEDPQRSGWQLVFVDRENDVLLLGDDPWQ
Download sequence
Identical sequences A0A067FB93
orange1.1g003298m|PACid:18127410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]