SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A067GFK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067GFK3
Domain Number 1 Region: 61-188
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000785
Family BTB/POZ domain 0.021
Further Details:      
 
Domain Number 2 Region: 260-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000834
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067GFK3
Sequence length 501
Comment (tr|A0A067GFK3|A0A067GFK3_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO77445.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g007849mg OC=Citrus.
Sequence
MANSIEPSSSLSFTSSSHLSNGSISHNQSSFSAPEKGVNLEVFSLNKLSSSLEQLLIDST
CEYSDAEIIVEGIPVCVHRCILAARSKFFYELFKREKGSVDKEGKPKYPMSELLPYGKVG
YEAFLIFLSYTYSGKLKPFPMEVSTCVDNICVHDACRPAINFAVEMMYASSIFELPELVS
LFQRRLLNFVGKAVAEDIIPILLAAFHCQLSQLLAQCVDRIVRSDLDTISIEKELPTEVA
EEIRMLRLKSFPDDENTAVEVDPLREKRIKRIHKALDSDDVELVRLLLSESEITLDEANA
LHYAAAYCDPKVLSEVLSLGLADVNLRSSRGYTVLHIGAMRKEPSVIVSLLTKGACASDL
TLDGRSAVSICRRLTRPKDYQAKTEQGKETNKDRICIDVLEGEMRRNPMAGDAFITSHTL
SDDLHMKLLYLENRVAFARLLFPTEAKLAMDIANTETTSEFSGFCASKGSSGNLREVDLN
ETPVMRNKRLRPRMEALMKTD
Download sequence
Identical sequences A0A067GFK3
orange1.1g010793m|PACid:18138819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]