SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072V0U1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072V0U1
Domain Number 1 Region: 58-140
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-16
Family B3 DNA binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072V0U1
Sequence length 251
Comment (tr|A0A072V0U1|A0A072V0U1_MEDTR) B3 DNA-binding domain protein {ECO:0000313|EMBL:KEH34983.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_3g075140 OC=Trifolieae; Medicago.
Sequence
MYDISTFLYSTCEAILNILCPKIRKGYIQHFLHPRVFLFILLPFRAPRENKNSAMVRNQQ
DLPSKLNPTMSLLVDQKINLEDSTGKRWAITVSEVDGSFAFKKGWDDFSSAHKLEIGDLL
VFNCINKYNFDVKIYDQSMCERIDFSDKRKRKKRSRCSSGSLDAGGTPNSVEVVSENVNV
DRSVKCPRTSEDTSYIRNHVYLNDAAIFNNDPMFEEVLGSGDTSYASKFGLLDRKDFFWS
QVQDSQVTESL
Download sequence
Identical sequences A0A072V0U1
XP_013460949.1.50012 Medtr3g075140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]