SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072VGJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072VGJ6
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-18
Family B3 DNA binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  A0A072VGJ6
Domain Number - Region: 273-321
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000294
Family B3 DNA binding domain 0.014
Further Details:      
 
Domain Number - Region: 200-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0471
Family B3 DNA binding domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A072VGJ6
Sequence length 324
Comment (tr|A0A072VGJ6|A0A072VGJ6_MEDTR) Plant-specific B3-DNA-binding domain protein {ECO:0000313|EMBL:KEH41174.1} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_1g046200 OC=Trifolieae; Medicago.
Sequence
MAKDYPDFFKVFSTEKHTERMRIPNAFVNLMRSKRKVIKDFILRDRRGRDWHVKARLIGD
ELYFDGGWKQFREENSLEEDDFLVFTHIENTVFRFKILELSSMCEKKKVSVVEENNNMED
EEEVNDGDDDDEDDDYEYDAAAAADDDGDDDDENERMYKEISRSKHQHCRTCCKCKAGNI
GSSSARSKLEDDEIDAEIYIQPGNPHFIAKYIHSRPNELFIPKNVIKDFCLCFTKHVTLE
CCHCKDIQSNDLAAYHHILPQISTIHIEKRGQVRTWRDGRVRVLGWEDFCRKSKITENDS
CLCEIVLREDGTIRILRVHVVRKE
Download sequence
Identical sequences A0A072VGJ6
Medtr1g046200.1 XP_013467138.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]