SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A072VH97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A072VH97
Domain Number 1 Region: 32-68
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000314
Family B3 DNA binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A072VH97
Sequence length 137
Comment (tr|A0A072VH97|A0A072VH97_MEDTR) Uncharacterized protein {ECO:0000313|EMBL:KEH40803.1, ECO:0000313|EnsemblPlants:KEH40803} KW=Complete proteome; Reference proteome OX=3880 OS=Medicago truncatula (Barrel medic) (Medicago tribuloides). GN=MTR_1g035540 OC=Trifolieae; Medicago.
Sequence
MWFQQQHSNGRGSEDHGMHFYLPIQQHKELVGWKSFSKEHDLKVGDVCKFEMAQREPLSF
TIIIIPATEEPCPEQFQGSVSPNSHDKFKVSVTSLDKLLYIPSPKSSAYSTSSTAVVSDF
SRTRVFSACPQTLSRIQ
Download sequence
Identical sequences A0A072VH97
Medtr1g035540.1 XP_013466762.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]