SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074Y749 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A074Y749
Domain Number 1 Region: 27-76
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000146
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 93-137
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000000275
Family Zn2/Cys6 DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A074Y749
Sequence length 904
Comment (tr|A0A074Y749|A0A074Y749_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KEQ93598.1} KW=Complete proteome; Reference proteome OX=1043005 OS=Aureobasidium subglaciale EXF-2481. GN=AUEXF2481DRAFT_47559 OC=Aureobasidium.
Sequence
MENPSPASVLGKHARDESSEQTPQESSKLFQCGDCRKSYSRVDHLARHVRLHTKEKPYLC
QTCNKSFARADLLKRHVAGHEARGEQSANTPAPNRQGRVSKACEACAELHIRCDEQKPCT
RCNKKQMTCVYQSSPPPPDKEAVARDLLAFASEPVVMPSDMPSMNPTITHPMGMNDMNQD
DVSLSSSFMEPPRPYQASTEPMINMTTADDQMVDPSLTQQNPGHVSVPAYENDGSFLHDF
LQSIIGGDPFPRQPAPGELIPGTWTPRNVFDFGTNTDLELNDLDLGFLDGYNHEIPFASF
VETPETARSIPGSTSDPPSALGVESLQKSSTWRFRPVTQDRGMNDQQNISMPNGDTSKRL
PVQRRVTSEMLSYNMRDRIMALFMSSANADTLQKTMLSFPSLELLDSLLQYFLSSKTAIS
NRMIHLPTFRPNNARPELIAAMVVGGATLAPDISLRKMGFALMEVVRVGVPNNIERDNTL
IGDVECVTSLGIGLSSGLWSGNSRKMEIAESFLQPYLTMCRRRGWFRRSAYEAIIPYSTD
TGKALEDKWHAWAKQEMRKRLVFYLLEYDTRQSITLFTNPLISYAELGLPLPEAESLWIA
ATAEKWKQTYMSLDQHKQREPSLTDLLQDVELLGEGHDMFDETTASQALLSAAWRLIWEY
RQMCSISRGQASSWSNSNLLLSSRLTELTRLLDCVKMSSHTNVAMTLSLELLLMHLHISL
EEMHLFAGAEGHSEARRVFPLLQEWAKSSSARQGVYHAAQIVAAARKIPTGCLRDFHAIV
LYQAGLALWSYGVISNAALTESALDSIGNISARRGESVAMLDETDSNGAQRFISLNKGQA
AIKKAVGDPSGTHVLLSEPAAVMSVLMDIFRMNGRPPRSAPPLVENLLELMEGLRLAVLE
PGTC
Download sequence
Identical sequences A0A074Y749
jgi|Aurpu_var_sub1|47559|fgenesh1_pm.16_#_59 XP_013342098.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]