SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A074YU63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A074YU63
Domain Number - Region: 249-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0186
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A074YU63
Sequence length 364
Comment (tr|A0A074YU63|A0A074YU63_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KEQ99699.1} KW=Complete proteome; Reference proteome OX=1043005 OS=Aureobasidium subglaciale EXF-2481. GN=AUEXF2481DRAFT_696471 OC=Aureobasidium.
Sequence
MPPIFKEPDLTAEDIARGDRHRTHGSPWVLFLRPRSDFDGSAWCTVHQNAWELVLKVLRF
ARTVDDAYYEAAMVAMRRWNADHAMSADPTHFLIYLEQQIQMEGGRLRENSYIWRAYSDC
NGPQTLTFSRFEDSSPTEPNLAVDETSAEFFLAETMLNYRLRSLAYISNEECKVELRLDR
RSLLGVPLTSPAMVMDATREAYTAVNKVIPNWLTLQLPAHLAPLSLSSPTPSHGRQTPSQ
GNPLGIIKRPHKCPFCRSCFSTEPRRDTHIQSVHGGQIALAAQQHATDQIPAAPTTSAPP
GCAPASDTPLGYAPASAIPWEYAPTSAIPLGPQSSATAEPEIGDEEETGPVEIVPHGSPD
SVQP
Download sequence
Identical sequences A0A074YU63
jgi|Aurpu_var_sub1|696471|MIX1275_7_43 XP_013348443.1.23603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]