SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077F7T9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077F7T9
Domain Number 1 Region: 12-74
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000392
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A077F7T9
Sequence length 380
Comment (tr|A0A077F7T9|A0A077F7T9_9PSED) ABC transporter permease {ECO:0000313|EMBL:AIL59361.1} KW=Complete proteome OX=237609 OS=Pseudomonas alkylphenolica. GN=PSAKL28_01230 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEPMTTQASATLDTTSNPACLRIVGDWTLANYASLKRSSERLAGQYDQRTEIDLEQLGQL
DTAGASLLAELLGAERLSRLTETAQLPEASRALLQAVYCSVQDFCIPEKQPEKSVLIQLL
SRIGCAVDTLWQDTLQILGFVGLILQTLVLRLFQPRRWRVTAVVAHIEQTGLDAAPIVAL
LTFLVGAVVAFLGATVLAGFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQIG
SMKANEEIDAIRTLGLDPVELLVVPRVLALLIALPLLTFLAMICGIIGGGVVCALSLDIS
PAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQS
IFVVIVLDAVAALFFMEMGW
Download sequence
Identical sequences A0A077F7T9
WP_038605281.1.97771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]