SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A077TQS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A077TQS9
Domain Number 1 Region: 13-483
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.49e-77
Family GABA-aminotransferase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A077TQS9
Sequence length 484
Comment (tr|A0A077TQS9|A0A077TQS9_PLACH) Serine hydroxymethyltransferase, putative {ECO:0000313|EMBL:CDR15470.1} KW=Complete proteome OX=31271 OS=Plasmodium chabaudi chabaudi. GN=PCHAS_132310 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKIVKELCKKGKVKWRRYISSQSLQNYNSLKNVDEDNYNILSTYKNKSYLNLSVCNNVIP
KYVHDCLVNNLNKNVTLNLEHLKIIEDRALAAFNLENKYWGCVFNTSSHSECTNSMDEYF
LLKLFRNFVNYQSKIMIISFTLLDKETHEENNKEENRTDKNVLNEFYNILYIKNNDKINY
MEIKNQYEQFKPDLIYIDETNNPYNFDYEFITTLRNMKSKINNNVNSEKEGVEDKSNTLV
MTNISNKASFIIEKFISSPFSQADIVFSYLNENIRANNCYIIFYRKGFKNISTQGKLICY
EYEEKLKKTFFQNNVNNIICSLSTSFKCIQNHEFKEYIHQINKNINVLFSYLNKKYFNIH
FDQNNNFLNIACSNSLFNIQEYHMFCKKINILFDIININKSIYPQKSFNIGTNYLTALGM
EEHDMKYVSEFINQSILLYLYTKQKSANSNLTFLEYLENNFISSDILALSNDIHSFVSMF
PSPS
Download sequence
Identical sequences A0A077TQS9
PCAS_132310 XP_744357.2.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]