SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A087CHU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087CHU1
Domain Number 1 Region: 10-286
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-79
Family Protein kinases, catalytic subunit 0.000000156
Further Details:      
 
Domain Number 2 Region: 598-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000484
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0065
Further Details:      
 
Domain Number 3 Region: 533-593
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000667
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087CHU1
Sequence length 716
Comment (tr|A0A087CHU1|A0A087CHU1_9BIFI) Serine-threonine protein kinase {ECO:0000313|EMBL:KFI82841.1} KW=Complete proteome; Reference proteome OX=218140 OS=Bifidobacterium psychraerophilum. GN=BPSY_0632 OC=Bifidobacterium.
Sequence
MSTTLPSSLANGRYELGQLIGRGGMAEVHVAQDARLGRTVAIKIMRSDLTNDEIFLSRFR
REAHSVAQLNNPNIVSIYDSGEETLEDENGNHERVPYLVMEYVKGQTLRDIIKSNGPLSQ
RDAEQVMLGVLNALEYSHRMGIIHRDIKPGNIMISDQGMVKVMDFGIARALDDSAATMTQ
SQGVVGTAQYLSPEQARGESVDMRSDLYSAGCVLYEMLTGRPPFKGDSAVAIAYQHVSEV
ATPPSAIIPGLPKMWDSICAKAMAKDRQNRYGTAADFKNDVLTFMNGGTPLAAAFNPLTD
LSNMKARKDAEQDATTVAMNSPTETLAATQAFNPAMGQSGPATGNIATATRAEQRAADNK
KSRRKKIILWSIVGALVLAAAVAAIWFLNKPASVETVTVPEITSQMSAARAQEKIESAGL
VFQEKQDTDSTEPQGTFTKQSPKGGAKVDKGSTVTVWFSTGPQSVKVPDVTGKSQDEARQ
ELESAGFTVGSTASVEDSGTVEKDHVTRTDPAAGQALSKGSSVLLYISSGMTKVPDVTGK
SQADALQTLNDQGFNTNTTQENSDTVPTGSVTRSNPAAGTSVEQGTAITVYVSKGKEQVT
VPNVVGMTLKDAKSTIGSSLSVTTKGSSDDSATVTSTDPAAGSSVDKGSTITLTTSAPSA
TFDPNSVVGMSQSDATTELQSNGYTVKKNDSSSDDSATVTKITVSNKQVTLYVDSN
Download sequence
Identical sequences A0A087CHU1
WP_081884186.1.13512 WP_081884186.1.34873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]